PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9308_f_11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 290aa    MW: 32788.9 Da    PI: 8.9785
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9308_f_11genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.7e-41167244178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  Neem_9308_f_11 167 RCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQ 244
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-35161229IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.265165242IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-38166245IPR004333Transcription factor, SBP-box
PfamPF031107.4E-31168241IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MVDYEWGNPS TIMLTGDEPN QESNQTRQIF DHYTNPNSFN DANNNTNNYF SEPAGANTTL  60
FHHQQQQHNV HSLFDPRAYN SASAYAPATH HHSMLSIDAV SAAAAGGGGG YFVIPKTEEV  120
SRPTDFASRI GLNLGGRTYF SSADDDFVNR LYRRPRPGEP GSSNIPRCQA EGCNADLTHA  180
KHYHRRHKVC EFHSKASTVI AAGLTQRFCQ QCSRFHLLSE FDNGKRSCRK RLADHNRRRR  240
KSQQQQQPAQ DNQKSHQLES ARNSPSENLA RKIEGREDAA VMRSPTWRLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-33158241184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445347.11e-137hypothetical protein CICLE_v10021106mg
RefseqXP_006445348.11e-137hypothetical protein CICLE_v10021106mg
RefseqXP_006445349.11e-137hypothetical protein CICLE_v10021106mg
RefseqXP_006464477.11e-137PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL32e-88SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A067HCP31e-137A0A067HCP3_CITSI; Uncharacterized protein
TrEMBLA0A067HCW11e-137A0A067HCW1_CITSI; Uncharacterized protein
TrEMBLV4TE211e-137V4TE21_9R
TrEMBLV4TYA71e-137V4TYA7_9R
TrEMBLV4VYP01e-137V4VYP0_9R
STRINGVIT_15s0021g02300.t011e-117(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70102743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-81squamosa promoter binding protein-like 8